Dactylosporangium aurantiacum: Daura_17695 Help Entry Daura_17695       CDS       T08497                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism daur  Dactylosporangium aurantiacum Pathway daur00261   Monobactam biosynthesis daur01100   Metabolic pathways daur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:daur00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Daura_17695  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:daur01008]     Daura_17695 Polyketide biosynthesis proteins [BR:daur01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Daura_17695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UWZ57837 UniProt:  A0A9Q9MQR6 LinkDB All DBs Position complement(3926315..3926491) Genome browser AA seq 58 aa AA seqDB search MSEERFQVVRNDEDQYSIWPAGEAPPAGWHPDGTTGPRQECLDHIDAVWTDMRPRGAR NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgagcgaggagcggttccaggtggtccgcaacgacgaggaccagtactcgatctggccg gccggcgaggcaccgcccgccgggtggcaccccgacggcaccaccggcccgcggcaggag tgcctcgaccacatcgacgccgtgtggaccgacatgcgtccgcgcggcgcgcgctga

DBGET integrated database retrieval system