Dactylosporangium aurantiacum: Daura_34415 Help Entry Daura_34415       CDS       T08497                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism daur  Dactylosporangium aurantiacum Pathway daur00261   Monobactam biosynthesis daur01100   Metabolic pathways daur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:daur00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Daura_34415  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:daur01008]     Daura_34415 Polyketide biosynthesis proteins [BR:daur01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Daura_34415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UWZ51794 UniProt:  A0A9Q9I8M5 LinkDB All DBs Position complement(7762857..7763096) Genome browser AA seq 79 aa AA seqDB search MSSNPFDDENGTFFVLVNDEDQHSLWPTFAAVPAGWRIVFGENGRTGRQECLDYVERHWT DLRPRSLRESMARDTAAAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaacccgttcgacgacgagaacggcacgttcttcgtgctcgtcaacgacgag gaccagcactcgctgtggccgacgttcgccgcggtgccggccggctggcgcatcgtcttc ggcgagaacggccggaccgggcgccaggagtgcctggactacgtcgagcggcactggacc gacctacggcccaggagcctccgcgagagcatggcgcgggacaccgccgcggccgcctga

DBGET integrated database retrieval system