Desulfomarina profundi: DGMP_34370 Help Entry DGMP_34370        CDS       T07650                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dbk  Desulfomarina profundi Pathway dbk00020   Citrate cycle (TCA cycle) dbk01100   Metabolic pathways dbk01110   Biosynthesis of secondary metabolites dbk01120   Microbial metabolism in diverse environments dbk01200   Carbon metabolism dbk01210   2-Oxocarboxylic acid metabolism Module dbk_M00009   Citrate cycle (TCA cycle, Krebs cycle) dbk_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dbk00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DGMP_34370 Enzymes [BR:dbk01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DGMP_34370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_10 Fer4_7 Fer4_9 Fer4_2 Fer4_4 ETF_QO Fer4_16 Fer4_6 Fer4_15 Fer4_8 Fer4_17 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  BCL62744 UniProt:  A0A8D5FQV3 LinkDB All DBs Position 3734635..3734859 Genome browser AA seq 74 aa AA seqDB search MARQKLREIVINRDWCKGCGICVHFCPTKVLELDAEDKSVAVRPEDCICCKMCELRCPDL AIEVLTDQGENNEE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggccaggcagaaactcagggaaattgtgataaaccgggattggtgcaaagggtgtggt atatgtgttcacttttgcccgacgaaggttctggagcttgacgcagaggataaatcggtg gcggtcaggccggaggactgtatctgttgtaaaatgtgtgaactacggtgcccggatctc gcaatcgaggtactgacagaccagggtgagaacaatgaagaataa

DBGET integrated database retrieval system