Desulfomarina profundi: DGMP_34370 Help Entry DGMP_34370        CDS       T07650                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dbk  Desulfomarina profundi Pathway dbk00020   Citrate cycle (TCA cycle) dbk00720   Other carbon fixation pathways dbk01100   Metabolic pathways dbk01110   Biosynthesis of secondary metabolites dbk01120   Microbial metabolism in diverse environments dbk01200   Carbon metabolism dbk01210   2-Oxocarboxylic acid metabolism Module dbk_M00009   Citrate cycle (TCA cycle, Krebs cycle) dbk_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dbk00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DGMP_34370   09102 Energy metabolism    00720 Other carbon fixation pathways     DGMP_34370 Enzymes [BR:dbk01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DGMP_34370 SSDB OrthologParalogGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_10 Fer4_7 Fer4_9 Fer4_2 Fer4_4 Fer4_ETF_QO Fer4_6 Fer4_16 LdpA_Fe-S-bd Fer4_17 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  BCL62744 UniProt:  A0A8D5FQV3 LinkDB All DBs Position 3734635..3734859 Genome browser AA seq 74 aa AA seqDB search MARQKLREIVINRDWCKGCGICVHFCPTKVLELDAEDKSVAVRPEDCICCKMCELRCPDL AIEVLTDQGENNEE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggccaggcagaaactcagggaaattgtgataaaccgggattggtgcaaagggtgtggt atatgtgttcacttttgcccgacgaaggttctggagcttgacgcagaggataaatcggtg gcggtcaggccggaggactgtatctgttgtaaaatgtgtgaactacggtgcccggatctc gcaatcgaggtactgacagaccagggtgagaacaatgaagaataa

DBGET integrated database retrieval system