Oleidesulfovibrio alaskensis: Dde_0043 Help Entry Dde_0043          CDS       T00294                                  Name (GenBank) Ferrodoxin-like protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dde  Oleidesulfovibrio alaskensis Pathway dde00020   Citrate cycle (TCA cycle) dde01100   Metabolic pathways dde01110   Biosynthesis of secondary metabolites dde01120   Microbial metabolism in diverse environments dde01200   Carbon metabolism dde01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dde00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Dde_0043 Enzymes [BR:dde01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Dde_0043 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_10 Fer4_6 Fer4_2 Fer4_9 Fer4_8 Fer4_4 Fer4_16 Fer4_13 Fer4_17 Fer4_3 Fer4_15 ICAM_N Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  ABB36844 UniProt:  Q317N2 LinkDB All DBs Position 34764..35009 Genome browser AA seq 81 aa AA seqDB search MARVTFLDERCKGCLLCTTVCPKEIIRQSSRFNRKGYKVAEVTEEDMEQCTGCASCALIC PDLAIRVYRPEKPAKGEKAKE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcacgggttacttttctggatgaacggtgcaaggggtgcctgctgtgcaccactgtc tgccccaaggaaatcatccgtcagtcttcccgctttaaccgtaaagggtacaaagtggcc gaagtgactgaagaggacatggaacagtgtacggggtgcgcttcgtgcgcgcttatctgc cccgacttagcgatacgggtataccggcccgaaaagcccgccaaaggcgaaaaggcaaag gagtag

DBGET integrated database retrieval system