Pseudodesulfovibrio mercurii: DND132_1252 Help Entry DND132_1252       CDS       T01709                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ddn  Pseudodesulfovibrio mercurii Pathway ddn00020   Citrate cycle (TCA cycle) ddn01100   Metabolic pathways ddn01110   Biosynthesis of secondary metabolites ddn01120   Microbial metabolism in diverse environments ddn01200   Carbon metabolism ddn01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ddn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DND132_1252 Enzymes [BR:ddn01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DND132_1252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_6 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_20 Fer4_15 Fer4_18 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  EGB14461 UniProt:  F0JCG3 LinkDB All DBs Position 1379256..1379471 Genome browser AA seq 71 aa AA seqDB search MSEKHHVIDARRCKACGLCVDNCPKAVLALGTAINAQGYNYVVQEHPENCVLCDICGTIC PDMAIGVVVDQ NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaaacatcatgtcattgacgcccgccgctgcaaggcctgcgggctttgcgtg gacaactgccccaaggcggttcttgccctcggcaccgcaatcaatgcgcagggatacaac tacgtcgtccaggaacacccggaaaactgcgtactttgcgacatttgcggcaccatctgc cccgacatggccatcggtgtcgtcgtagaccagtaa

DBGET integrated database retrieval system