Desulfovibrio sp. G11: CNY67_00780 Help Entry CNY67_00780       CDS       T05183                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism def  Desulfovibrio sp. G11 Pathway def00020   Citrate cycle (TCA cycle) def01100   Metabolic pathways def01110   Biosynthesis of secondary metabolites def01120   Microbial metabolism in diverse environments def01200   Carbon metabolism def01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:def00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CNY67_00780 Enzymes [BR:def01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CNY67_00780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_6 Fer4_9 Fer4_16 Fer4_4 Fer4_3 Fer4_13 Fer4_8 Fer4_17 Fer4_22 Fer4_18 Fer4_15 DUF5651 Motif Other DBs NCBI-ProteinID:  ATD80118 UniProt:  A0A807ZFQ2 LinkDB All DBs Position complement(174817..175041) Genome browser AA seq 74 aa AA seqDB search MSRIVFLEERCKGCRLCVEACPVHILRPSGRFNRQGYEVMEMDGQCTGCASCAVMCPDVA IRVFKSAVKKGGEA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtcacgaatcgtgtttctggaagaacgctgcaagggctgccgcctgtgtgtggaagcc tgtcctgtacatattctgcggccatcgggccggtttaaccgccaggggtatgaggtcatg gagatggacgggcagtgcacgggatgcgcttcctgtgccgtcatgtgcccggatgtggcc atccgtgtcttcaaaagcgctgtaaagaaagggggcgaggcatga

DBGET integrated database retrieval system