Pseudodesulfovibrio indicus: AWY79_13785 Help Entry AWY79_13785       CDS       T04404                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dej  Pseudodesulfovibrio indicus Pathway dej00020   Citrate cycle (TCA cycle) dej01100   Metabolic pathways dej01110   Biosynthesis of secondary metabolites dej01120   Microbial metabolism in diverse environments dej01200   Carbon metabolism dej01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dej00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AWY79_13785 Enzymes [BR:dej01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AWY79_13785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_2 Fer4_9 Fer4_10 Fer4_21 Fer4_4 Fer4_16 Fer4_8 Fer4_6 Fer4_22 Fer4_17 Fer4_3 Fer4_15 Motif Other DBs NCBI-ProteinID:  AMK12104 UniProt:  A0A126QQ93 LinkDB All DBs Position complement(3036787..3037074) Genome browser AA seq 95 aa AA seqDB search MPKKNKGKNKVTIYPDWCKGCGICVEFCPAKVLGLSLQGKAVVEREEDCIRCGFCELHCP DFAIVVSDKEPMDNGLSDTDAETAPPKTKTGGKGA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcccaagaagaacaaaggcaagaacaaggtgaccatctacccggactggtgcaaaggc tgcggcatttgcgtcgaattctgtccggccaaggttctcggcctgagcctgcaaggcaag gccgttgtggagcgcgaggaggactgtatccggtgcgggttctgcgagctgcactgtccg gatttcgccatcgtggtcagcgacaaggaacccatggataacgggctgtccgacacggac gccgaaaccgcgccgccgaagaccaagacgggcgggaagggggcttag

DBGET integrated database retrieval system