Drosophila erecta: 6551803 Help Entry 6551803           CDS       T01060                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism der  Drosophila erecta Pathway der04013   MAPK signaling pathway - fly der04068   FoxO signaling pathway der04137   Mitophagy - animal der04140   Autophagy - animal der04150   mTOR signaling pathway der04213   Longevity regulating pathway - multiple species der04214   Apoptosis - fly der04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:der00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6551803    04068 FoxO signaling pathway     6551803    04150 mTOR signaling pathway     6551803  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6551803    04137 Mitophagy - animal     6551803   09143 Cell growth and death    04214 Apoptosis - fly     6551803  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     6551803   09149 Aging    04213 Longevity regulating pathway - multiple species     6551803  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:der04131]     6551803   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:der04031]     6551803 Membrane trafficking [BR:der04131]  Endocytosis   Macropinocytosis    Ras GTPases     6551803 GTP-binding proteins [BR:der04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     6551803 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Aldo_ket_red AAA_25 Motif Other DBs NCBI-GeneID:  6551803 NCBI-ProteinID:  XP_001980816 FlyBase:  FBgn0109593 UniProt:  B3NZR4 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL ASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKP NRRFKCKML NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaaactggtcgtcgttggagccggaggcgtgggcaagtccgcgctcacc atccagctaattcagaaccatttcgtggacgagtacgatcccacaatcgaggactcctac cgaaagcaagtggttatcgatggagagacctgcctgctggacatcctggacaccgccggc caagaggagtactcggcaatgcgcgatcagtatatgcggaccggagagggcttcctgctg gtctttgccgtcaacagtgcgaagtctttcgaggatatcggcacctaccgtgagcagatc aagcgcgtaaaggacgccgaagaggtgcccatggtgctggtgggcaacaaatgtgatctg gcctcgtggaacgttaacaacgagcaggcaagagaggtggccaaacagtacggcattcca tacattgagacatccgccaagacgcgcatgggcgtggacgatgcattttacacactggtg cgcgaaatccgcaaggacaaggacaacaaggggcggaggggccgaaaaatgaacaagccg aatcgtagatttaaatgtaaaatgctctaa

DBGET integrated database retrieval system