Devosia sp. MC521: H4N61_10125 Help Entry H4N61_10125       CDS       T08408                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism devo  Devosia sp. MC521 Pathway devo00790   Folate biosynthesis devo01100   Metabolic pathways devo01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:devo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     H4N61_10125 (folB) Enzymes [BR:devo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      H4N61_10125 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      H4N61_10125 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      H4N61_10125 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QMW61345 UniProt:  A0A7G5LH23 LinkDB All DBs Position 2136400..2136783 Genome browser AA seq 127 aa AA seqDB search MTTPFTGDRIILNDLGFFGYHGLFEEEAKLGQRFFIDLQCGVDLSPSGETDTITSTVSYA SIYDVVKAAFEAKRFNLIEAVAHTITTALFAEFPDINWIILRLRKPSAPIAMVSGEAAIE IHRVRPN NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgaccaccccattcaccggcgaccgtatcatcctcaatgatctaggctttttcggctat cacggcctctttgaggaagaagccaagctgggccaacgcttcttcatcgatttgcagtgc ggcgtcgatctcagcccgtccggcgaaaccgacaccatcacctcaaccgtcagctacgcc tcgatctatgacgtagtgaaagccgcctttgaggccaagcgcttcaacctgattgaagcc gtcgcccacaccatcaccactgccctcttcgctgagtttcctgacatcaactggatcatt ttgcgcctgcgcaaaccctcggcccccatcgctatggtgtcgggcgaagcggcaattgaa attcatcgcgtgagaccaaactaa

DBGET integrated database retrieval system