Desulforamulus ferrireducens: B0537_08305 Help Entry B0537_08305       CDS       T04823                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dfg  Desulforamulus ferrireducens Pathway dfg00020   Citrate cycle (TCA cycle) dfg01100   Metabolic pathways dfg01110   Biosynthesis of secondary metabolites dfg01120   Microbial metabolism in diverse environments dfg01200   Carbon metabolism dfg01210   2-Oxocarboxylic acid metabolism Module dfg_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dfg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     B0537_08305 Enzymes [BR:dfg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      B0537_08305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_10 Fer4_21 Fer4_7 Fer4_9 Fer4_16 Fer4_4 Fer4_22 Fer4_8 Fer4_17 Fer4_3 Fer4_15 Fer4_13 Motif Other DBs NCBI-ProteinID:  AQS59081 UniProt:  A0A1S6IWB9 LinkDB All DBs Position 1692544..1692771 Genome browser AA seq 75 aa AA seqDB search MTELSTVPGLPKTKVVINQSFCKKCGICIAFCNKAVLAAGEGNRIEVAQPEKCVGCGNCE NLCPDYAITLEVEEA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtgacagaattatcaactgtacctggcttgcccaaaaccaaagtggtcattaatcagtct ttctgtaagaaatgtggtatctgtattgctttttgtaacaaagctgtactggctgctgga gaaggtaaccgaatagaggtggcacaaccggaaaaatgtgtaggttgtgggaactgcgaa aacctttgcccggattatgccatcactctggaggtggaagaagcatga

DBGET integrated database retrieval system