Desulfovibrio fairfieldensis: AXF13_14925 Help Entry AXF13_14925       CDS       T04293                                  Name (GenBank) (Fe-S)-binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dfi  Desulfovibrio fairfieldensis Pathway dfi00020   Citrate cycle (TCA cycle) dfi01100   Metabolic pathways dfi01110   Biosynthesis of secondary metabolites dfi01120   Microbial metabolism in diverse environments dfi01200   Carbon metabolism dfi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dfi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AXF13_14925 Enzymes [BR:dfi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AXF13_14925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_16 Fer4_6 Fer4_9 Fer4_4 Fer4_3 Fer4_8 Fer4_13 Fer4_17 Fer4_18 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AMD91316 UniProt:  A0A0X8JM78 LinkDB All DBs Position 3528965..3529201 Genome browser AA seq 78 aa AA seqDB search MSRVVFLEDRCKGCRLCVEVCPVHILRPSGRFNRQGYEIMEMSGQCTGCASCAVMCPDTA IRVFRSVKAENAAEGGAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcacgagtagtttttctggaagatcgctgcaagggctgccggctctgtgtggaggtc tgccctgtccatatcctgcgtccgtcaggccgtttcaaccgccagggttatgaaatcatg gaaatgagcggccagtgcacgggctgcgcgtcctgcgccgtcatgtgcccggacacggcc atccgggtgttcagaagcgtcaaagccgaaaacgcggccgaaggaggcgcggtatga

DBGET integrated database retrieval system