Desulfovibrio ferrophilus: DFE_0178 Help Entry DFE_0178          CDS       T05829                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dfl  Desulfovibrio ferrophilus Pathway dfl00020   Citrate cycle (TCA cycle) dfl01100   Metabolic pathways dfl01110   Biosynthesis of secondary metabolites dfl01120   Microbial metabolism in diverse environments dfl01200   Carbon metabolism dfl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dfl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DFE_0178 Enzymes [BR:dfl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DFE_0178 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_9 Fer4_10 Fer4_4 Fer4_6 Fer4_8 Fer4_16 Fer4_17 Fer4_22 Fer4_3 ETF_QO Motif Other DBs NCBI-ProteinID:  BBD06904 UniProt:  A0A2Z6AUJ6 LinkDB All DBs Position complement(184194..184451) Genome browser AA seq 85 aa AA seqDB search MAKVQKGQTKITIYPDWCKGCGLCVAFCPGKVLELDPVEGCAKAIREEDCINCGFCELHC PDFAIVITPKDSKGSSEPNEGSKKS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcgaaagtacagaagggacaaacaaaaatcacaatctatccagactggtgcaaggga tgcgggctgtgtgtggccttttgccctggcaaggtcctggagcttgacccggtggaaggc tgtgccaaggccatccgggaagaggactgtatcaactgcggattctgcgaactccactgt ccggacttcgccattgtcatcacccccaaggacagcaaaggttcgagcgaacccaacgag gggagcaaaaaatcatga

DBGET integrated database retrieval system