Desulfovibrio ferrophilus: DFE_1780 Help Entry DFE_1780          CDS       T05829                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dfl  Desulfovibrio ferrophilus Pathway dfl00020   Citrate cycle (TCA cycle) dfl01100   Metabolic pathways dfl01110   Biosynthesis of secondary metabolites dfl01120   Microbial metabolism in diverse environments dfl01200   Carbon metabolism dfl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dfl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DFE_1780 Enzymes [BR:dfl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DFE_1780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_9 Fer4_10 Fer4_21 Fer4_16 Fer4_8 Fer4_17 Fer4_4 Fer4_20 Fer4_3 Fer4_18 Fer4_15 B3GALT2_N Fer4_13 LAM_C RUBY_RBDX Motif Other DBs NCBI-ProteinID:  BBD08506 UniProt:  A0A2Z6AZC5 LinkDB All DBs Position complement(1901829..1902044) Genome browser AA seq 71 aa AA seqDB search MSEKRHIIDARRCKACGLCVDNCPKGVLAIGGKINAQGYNYVIQENPEKCVLCDICGMIC PDMAIGVVAEK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaaaagacatatcattgatgcccgtcgctgtaaggcatgcggtctttgcgtg gacaattgtcctaagggcgttcttgctattggcggcaaaatcaatgctcaaggctacaat tacgtgattcaggaaaatcctgaaaaatgtgttctttgtgatatttgcggcatgatttgt cctgacatggccattggtgtcgtcgctgaaaaataa

DBGET integrated database retrieval system