Delftia sp. HK171: BO996_06355 Help Entry BO996_06355       CDS       T04584                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism dhk  Delftia sp. HK171 Pathway dhk00790   Folate biosynthesis dhk01100   Metabolic pathways dhk01240   Biosynthesis of cofactors Module dhk_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:dhk00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BO996_06355 Enzymes [BR:dhk01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BO996_06355  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BO996_06355  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BO996_06355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  APE47500 LinkDB All DBs Position complement(1415624..1415995) Genome browser AA seq 123 aa AA seqDB search MHSATGQQILTLTGLRFDANLGILAHEKQMPQPIQVDAELSLGTQPLAPRDDDILHVLDY RKVRQIIIDECTAEHVNLLESLIGKLAQRLMQLPGVLGVRVKIAKLEIFEDCEVAIRIET GQW NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcactccgccaccggacaacagatcctgacgctcacgggtttgcgcttcgacgccaac ctgggcatcctcgcccacgaaaaacagatgccccagcccatccaggtcgatgccgagctg agcctgggcacccaaccgctggcgccgcgcgacgacgacatcctgcatgtgctggactac cgcaaggtgcgccagatcatcatcgatgaatgcacggccgagcacgtcaacctgctggag agcctgatcggcaagctggcccagcgcctgatgcagctgcccggcgtgctgggcgtgcgc gtgaaaatcgccaagctggaaatctttgaagactgcgaagtggccattcgcatagaaacc ggacaatggtga

DBGET integrated database retrieval system