Dietzia sp. JS16-p6b: CT688_02800 Help Entry CT688_02800       CDS       T05397                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism diz  Dietzia sp. JS16-p6b Pathway diz00790   Folate biosynthesis diz01100   Metabolic pathways diz01240   Biosynthesis of cofactors Module diz_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:diz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CT688_02800 (folB) Enzymes [BR:diz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CT688_02800 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CT688_02800 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CT688_02800 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Phage_holin_7_1 Motif Other DBs NCBI-ProteinID:  AVZ41023 LinkDB All DBs Position 622073..622465 Genome browser AA seq 130 aa AA seqDB search MADRIELRGLRVRGHHGVFEHERHDGQDFLVDLVLWTDFSAAAASDDLADTVDYGALALF ARDVVSGAPRDLIETVASQIADGVMDLAPHAHAVEVTVHKPQAPIPAEFADVAVVARRSR GHDGEPGADR NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggcggaccggatcgaactcaggggcctgcgggtgcgcggccaccacggggtcttcgag cacgagcggcacgacggtcaggacttcctcgtcgacctcgtcctgtggaccgacttctcc gcggccgcggcgtccgacgatctggccgacaccgtcgactacggtgcgctggcgctgttc gcccgggacgtggtgtccggggccccccgcgacctgatcgagacggtggcctcgcagatc gccgacggggtcatggacctggccccccacgcgcacgcggtggaggtgaccgtgcacaag ccccaggcgcccatccccgccgagttcgcggacgtcgcggtggtggccagacgatcgcgt gggcacgacggcgaaccgggtgcggaccggtga

DBGET integrated database retrieval system