Desulfofustis limnaeus: DPPLL_15690 Help Entry DPPLL_15690       CDS       T09067                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dlm  Desulfofustis limnaeus Pathway dlm00020   Citrate cycle (TCA cycle) dlm00720   Other carbon fixation pathways dlm01100   Metabolic pathways dlm01110   Biosynthesis of secondary metabolites dlm01120   Microbial metabolism in diverse environments dlm01200   Carbon metabolism dlm01210   2-Oxocarboxylic acid metabolism Module dlm_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dlm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DPPLL_15690   09102 Energy metabolism    00720 Other carbon fixation pathways     DPPLL_15690 Enzymes [BR:dlm01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DPPLL_15690 SSDB OrthologParalogGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_21 Fer4_9 Fer4_2 Fer4_8 Fer4_16 Fer4_17 Fer4_22 LdpA_Fe-S-bd Fer4_6 Fer4_4 Motif Other DBs NCBI-ProteinID:  BDD87204 UniProt:  A0ABN6M599 LinkDB All DBs Position 1679828..1680241 Genome browser AA seq 137 aa AA seqDB search MEKKEKEQPEPDENRKKGSAQSRKKGTVARTEDKATTQSEKLMEQSAENDQRAANQGEAK GKKTLYRVKFFYEWCKCCGICSAMCPVKIILVDEQGHPYIDDQDGCIGCRNCEIHCPDFA ITVSKRYPERRKTNGIS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaaaagagaaagagcaacccgaaccggacgagaaccgcaagaaaggttcagct caatcacggaagaaaggaacagtggcccgtacggaagataaagcgaccacgcaatcggaa aagctcatggaacaatctgctgaaaacgatcaacgagcagcaaatcaaggcgaggcgaaa gggaaaaagaccttatatcgggtcaagtttttttatgaatggtgcaagtgctgcggcatc tgcagcgccatgtgtccggtgaagatcatcctggtcgatgaacaggggcacccatacatt gacgatcaggatggctgcatcggttgccggaattgcgaaattcactgccccgattttgct attaccgtgtccaagcgatatccggaaaggaggaagacaaatggcatcagctga

DBGET integrated database retrieval system