Desulfofustis limnaeus: DPPLL_15690 Help Entry DPPLL_15690       CDS       T09067                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dlm  Desulfofustis limnaeus Pathway dlm00020   Citrate cycle (TCA cycle) dlm01100   Metabolic pathways dlm01110   Biosynthesis of secondary metabolites dlm01120   Microbial metabolism in diverse environments dlm01200   Carbon metabolism dlm01210   2-Oxocarboxylic acid metabolism Module dlm_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dlm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DPPLL_15690 Enzymes [BR:dlm01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DPPLL_15690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_21 Fer4 Fer4_9 Fer4_10 Fer4_8 Fer4_2 Fer4_22 Fer4_16 Fer4_6 Fer4_17 Fer4_4 Motif Other DBs NCBI-ProteinID:  BDD87204 LinkDB All DBs Position 1679828..1680241 Genome browser AA seq 137 aa AA seqDB search MEKKEKEQPEPDENRKKGSAQSRKKGTVARTEDKATTQSEKLMEQSAENDQRAANQGEAK GKKTLYRVKFFYEWCKCCGICSAMCPVKIILVDEQGHPYIDDQDGCIGCRNCEIHCPDFA ITVSKRYPERRKTNGIS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaaaagagaaagagcaacccgaaccggacgagaaccgcaagaaaggttcagct caatcacggaagaaaggaacagtggcccgtacggaagataaagcgaccacgcaatcggaa aagctcatggaacaatctgctgaaaacgatcaacgagcagcaaatcaaggcgaggcgaaa gggaaaaagaccttatatcgggtcaagtttttttatgaatggtgcaagtgctgcggcatc tgcagcgccatgtgtccggtgaagatcatcctggtcgatgaacaggggcacccatacatt gacgatcaggatggctgcatcggttgccggaattgcgaaattcactgccccgattttgct attaccgtgtccaagcgatatccggaaaggaggaagacaaatggcatcagctga

DBGET integrated database retrieval system