Dactylosporangium matsuzakiense: Dmats_26235 Help Entry Dmats_26235       CDS       T08700                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism dmat  Dactylosporangium matsuzakiense Pathway dmat00261   Monobactam biosynthesis dmat01100   Metabolic pathways dmat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dmat00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Dmats_26235  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:dmat01008]     Dmats_26235 Polyketide biosynthesis proteins [BR:dmat01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Dmats_26235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UWZ41202 LinkDB All DBs Position complement(5733761..5733970) Genome browser AA seq 69 aa AA seqDB search MEDDDDRRYTVVVNDEEQYSIWPEGRDIPGGWREAGRAGTKAECLAYVEEVWTDMRPLSL RRQLESLAQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaggacgacgacgaccgccgctacaccgtggtggtcaacgacgaggagcagtactcg atctggcccgaggggcgcgacatccccggcggctggcgcgaggccgggcgcgccggcacc aaggccgagtgcctggcctacgtcgaggaggtctggaccgacatgcgcccgctgagcctg cgccggcagctggaatccctcgcgcagtga

DBGET integrated database retrieval system