Drosophila melanogaster (fruit fly): Dmel_CG9375 Help Entry Dmel_CG9375       CDS       T00030                                  Symbol Ras85D Name (RefSeq) Ras oncogene at 85D   KO K07827   GTPase KRas Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04013   MAPK signaling pathway - fly dme04068   FoxO signaling pathway dme04137   Mitophagy - animal dme04140   Autophagy - animal dme04150   mTOR signaling pathway dme04213   Longevity regulating pathway - multiple species dme04214   Apoptosis - fly dme04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:dme00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     Dmel_CG9375 (Ras85D)    04068 FoxO signaling pathway     Dmel_CG9375 (Ras85D)    04150 mTOR signaling pathway     Dmel_CG9375 (Ras85D)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     Dmel_CG9375 (Ras85D)    04137 Mitophagy - animal     Dmel_CG9375 (Ras85D)   09143 Cell growth and death    04214 Apoptosis - fly     Dmel_CG9375 (Ras85D)  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     Dmel_CG9375 (Ras85D)   09149 Aging    04213 Longevity regulating pathway - multiple species     Dmel_CG9375 (Ras85D)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG9375 (Ras85D)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dme04031]     Dmel_CG9375 (Ras85D) Membrane trafficking [BR:dme04131]  Endocytosis   Macropinocytosis    Ras GTPases     Dmel_CG9375 (Ras85D) GTP-binding proteins [BR:dme04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     Dmel_CG9375 (Ras85D) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Aldo_ket_red AAA_25 Motif Other DBs NCBI-GeneID:  41140 NCBI-ProteinID:  NP_476699 FlyBase:  FBgn0003205 UniProt:  P08646 LinkDB All DBs Position 3R Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL ASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKP NRRFKCKML NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaaactggtcgtcgttggagccggaggcgtgggcaagtccgcgctcacc atccagctaatccagaaccatttcgtggacgagtacgaccccacaatcgaggactcttac cgaaagcaagtggttatcgatggagagacctgcctgctggacatcctggacaccgccggc caagaggagtactcggccatgcgggatcagtatatgcggactggcgagggattcctgctg gtctttgccgtcaacagtgcgaagtccttcgaggatatcggcacctaccgtgagcagatc aagcgcgtaaaggatgccgaagaggtgcccatggtgctggtgggcaacaaatgtgatctg gcctcgtggaacgttaacaacgagcaggcaagagaggtggccaaacagtacggcattcca tacattgagacatccgccaagacgcgcatgggcgtggacgatgcattttacacactggtg cgcgaaatccgcaaggacaaggacaacaaggggcggaggggccgcaaaatgaacaagccg aatcgtagatttaaatgtaaaatgctctaa

DBGET integrated database retrieval system