Desulfococcus multivorans: Dmul_17110 Help Entry Dmul_17110        CDS       T04568                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dml  Desulfococcus multivorans Pathway dml00020   Citrate cycle (TCA cycle) dml01100   Metabolic pathways dml01110   Biosynthesis of secondary metabolites dml01120   Microbial metabolism in diverse environments dml01200   Carbon metabolism dml01210   2-Oxocarboxylic acid metabolism Module dml_M00009   Citrate cycle (TCA cycle, Krebs cycle) dml_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dml00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Dmul_17110 Enzymes [BR:dml01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Dmul_17110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_7 Fer4_9 Fer4_10 Fer4_2 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_6 ETF_QO Fer4_3 Fer4_22 Fer4_15 Fer4_13 Motif Other DBs NCBI-ProteinID:  AOY58484 LinkDB All DBs Position complement(1924849..1925076) Genome browser AA seq 75 aa AA seqDB search MPKKTLKEHSINREWCKGCGICVHFCPKNVLALDEMEKVIAVRPEDCICCKLCEIRCPDL AIEVILEPEKQEASE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgccgaagaaaacactcaaggaacattccatcaatcgggaatggtgcaaggggtgcggt atctgcgtccacttctgccccaagaatgtgctggcgctggacgagatggagaaagtcatc gccgttcgcccggaagactgtatctgctgcaagctgtgtgaaatccggtgtccggacctc gccatcgaggtcattctcgaaccggaaaaacaggaggcttctgaataa

DBGET integrated database retrieval system