Dromaius novaehollandiae (emu): 112979706 Help Entry 112979706         CDS       T07572                                  Name (RefSeq) ferritin light chain-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism dne  Dromaius novaehollandiae (emu) Pathway dne00860   Porphyrin metabolism dne04216   Ferroptosis dne04217   Necroptosis Brite KEGG Orthology (KO) [BR:dne00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     112979706  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     112979706    04217 Necroptosis     112979706  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dne04147]     112979706 Enzymes [BR:dne01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      112979706 Exosome [BR:dne04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    112979706   Exosomal proteins of bladder cancer cells    112979706 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  112979706 NCBI-ProteinID:  XP_025949880 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search AAPAAPRRGPHGLCRPQKPERDAWGSALEAVEAALQLEKSVNQALLDLHRLAAEKGDPHL CDFLESHYLDEQVKAIKALGDHATNLRRLAAGTGGAAGAALGLGEYLFDRLSLEERS NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gcggcccccgcggccccccggcgcggcccccacggcctctgtcgcccgcagaagccggag cgcgacgcctggggctcggcgctggaggcggtggaggcggccctgcagctggagaagtcg gtcaaccaggcgctgctggacctgcaccgcctggcagccgagaagggcgacccgcacctc tgcgacttcctcgagtcccactacctggacgagcaggtcaaggccatcaaggcgctggga gaccatgccaccaacctgcggcgcctggcggccggcaccgggggggccgcgggggctgcg ctggggctcggcgagtacctcttcgaccgcctgagcctggaggagcgcagctga

DBGET integrated database retrieval system