Desulfobulbus oligotrophicus: HP555_04550 Help Entry HP555_04550       CDS       T06967                                  Name (GenBank) hypothetical protein   KO K03048   DNA-directed RNA polymerase subunit delta Organism dog  Desulfobulbus oligotrophicus Pathway dog03020   RNA polymerase Brite KEGG Orthology (KO) [BR:dog00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     HP555_04550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dog03021]     HP555_04550    03400 DNA repair and recombination proteins [BR:dog03400]     HP555_04550 Transcription machinery [BR:dog03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      HP555_04550 DNA repair and recombination proteins [BR:dog03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       HP555_04550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QQG65189 UniProt:  A0A7T5VC59 LinkDB All DBs Position 1003239..1003559 Genome browser AA seq 106 aa AA seqDB search MAPARMMQFVDQHVKNCRVCKTDLLLPDEIEQIRMFVLPDARMLKPSRTSGHDATPEISP DDDDDFETDDQYEDEDGQDIEEDEDDIEEDEDDIDVEDDLTDDDMI NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctcctgcgcggatgatgcagtttgtcgatcagcacgtcaagaactgccgagtatgt aaaaccgacctgttactccctgacgagattgaacagatacggatgtttgttttaccggat gccaggatgctcaaaccttccagaacgtctggtcacgacgccacgccggaaatttcacct gacgatgatgatgattttgagacagatgatcagtatgaagatgaagatggccaggatatc gaagaagatgaagacgatatcgaagaggatgaagacgacattgatgtcgaagacgatttg accgatgacgatatgatttaa

DBGET integrated database retrieval system