Desulfosporosinus orientis: Desor_4063 Help Entry Desor_4063        CDS       T01675                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dor  Desulfosporosinus orientis Pathway dor00020   Citrate cycle (TCA cycle) dor00720   Carbon fixation pathways in prokaryotes dor01100   Metabolic pathways dor01110   Biosynthesis of secondary metabolites dor01120   Microbial metabolism in diverse environments dor01200   Carbon metabolism dor01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dor00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Desor_4063   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     Desor_4063 Enzymes [BR:dor01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Desor_4063 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_9 Fer4 Fer4_7 Fer4_16 Fer4_10 Fer4_2 Fer4_21 Fer4_4 Fer4_6 Fer4_8 Fer4_13 Fer4_17 Fer4_3 ETF_QO Motif Other DBs NCBI-ProteinID:  AET69505 UniProt:  G7WFZ0 LinkDB All DBs Position complement(4190035..4190250) Genome browser AA seq 71 aa AA seqDB search MVTAIQDTKVIVTVDWCKKCGICIAFCPKKVLESDELGRVVVARPEQCIACKICERLCPD FAINIEVTKDE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt ttggttacagcaattcaagatactaaagtgattgtgacagtagattggtgtaaaaagtgc gggatatgcatagctttctgccccaaaaaagtgctggaaagcgatgaattggggagggta gttgttgccaggccggagcagtgcatagcctgtaaaatttgtgaacgattgtgtccggac tttgccataaacatcgaggtgacgaaagatgaataa

DBGET integrated database retrieval system