Desulfosarcina ovata subsp. sediminis: DSCO28_17810 Help Entry DSCO28_17810      CDS       T06286                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dov  Desulfosarcina ovata subsp. sediminis Pathway dov00020   Citrate cycle (TCA cycle) dov00720   Carbon fixation pathways in prokaryotes dov01100   Metabolic pathways dov01110   Biosynthesis of secondary metabolites dov01120   Microbial metabolism in diverse environments dov01200   Carbon metabolism dov01210   2-Oxocarboxylic acid metabolism Module dov_M00009   Citrate cycle (TCA cycle, Krebs cycle) dov_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dov00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DSCO28_17810   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     DSCO28_17810 Enzymes [BR:dov01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DSCO28_17810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_9 Fer4_2 Fer4_16 Fer4_4 Fer4_6 Fer4_8 Fer4_17 Fer4_15 Fer4_13 Fer4_3 ETF_QO Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  BBO81215 UniProt:  A0A5K7ZLN4 LinkDB All DBs Position complement(1930392..1930613) Genome browser AA seq 73 aa AA seqDB search MSKQKLKSHRINREWCKGCGICVAFCPKKVLELDREDKAVAVRLEDCIACRLCELRCPDL AITVETEDVPVPS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtcaaagcaaaaactcaagtcccatcgaatcaaccgggagtggtgcaagggatgcggg atctgcgtggccttctgcccgaagaaggtgctggagctggaccgggaagacaaggcggtg gcggtgcgccttgaagactgcattgcctgccggctgtgcgagctgcgctgcccggacctg gccatcaccgtcgaaacggaagatgttccggttccatcgtag

DBGET integrated database retrieval system