Dyadobacter pollutisoli: ON006_30995 Help Entry ON006_30995       CDS       T09794                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism dpf  Dyadobacter pollutisoli Pathway dpf00790   Folate biosynthesis dpf01100   Metabolic pathways dpf01240   Biosynthesis of cofactors Module dpf_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:dpf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ON006_30995 (folB) Enzymes [BR:dpf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ON006_30995 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ON006_30995 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ON006_30995 (folB) BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  WAC12143 UniProt:  A0A9E8NA32 LinkDB All DBs Position 7448743..7449093 Genome browser AA seq 116 aa AA seqDB search MGTISLEGLEFFAYHGYYPEEQRIGNKYALDITITTDFFKAAQYDKLSETVNYETIYQIA SKVMQEPAKLLEHIGFTVIEKIREYYPSVANITVRVSKFNPPVGGVCTRAVITMEG NT seq 351 nt NT seq  +upstreamnt  +downstreamnt ttgggaaccatcagcctggaaggattagagttttttgcgtaccacggttactatcccgag gaacagcggataggtaacaaatatgcactggatatcaccattactaccgattttttcaaa gccgcgcagtatgataagctcagcgaaacggtgaattacgaaaccatataccagattgcc tccaaggtcatgcaggagcctgccaaactgttggaacacattggtttcacggtcatcgaa aagatcagggaatattacccgtctgttgctaatattacagtaagggtttcaaaattcaat ccgccggtaggaggcgtctgcacgcgggcggtgattacgatggaagggtag

DBGET integrated database retrieval system