Daphnia pulex (common water flea): DAPPUDRAFT_211094 Help Entry DAPPUDRAFT_211094 CDS       T04347                                  Name (GenBank) hypothetical protein   KO K01520   dUTP diphosphatase [EC:3.6.1.23] Organism dpx  Daphnia pulex (common water flea) Pathway dpx00240   Pyrimidine metabolism dpx00983   Drug metabolism - other enzymes dpx01100   Metabolic pathways dpx01232   Nucleotide metabolism Module dpx_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:dpx00001]  09100 Metabolism   09104 Nucleotide metabolism    00240 Pyrimidine metabolism     DAPPUDRAFT_211094   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     DAPPUDRAFT_211094  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:dpx03400]     DAPPUDRAFT_211094 Enzymes [BR:dpx01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.23  dUTP diphosphatase      DAPPUDRAFT_211094 DNA repair and recombination proteins [BR:dpx03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     DAPPUDRAFT_211094  Prokaryotic type     DAPPUDRAFT_211094 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  dUTPase Motif Other DBs NCBI-ProteinID:  EFX81802 JGI:  Dappu1_211094 UniProt:  E9GFI8 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search MSGAALLRFAKLSQNAISPTRGSKHAAGYDLYSAYDYEVPAMGKVIAKTDIQIQLPEGCY GRVAPRSGLAANHHIDIGAGVIDRDYRGNVGVVMFNHSQTAFKVNKGDRVAQLICELILY PEIEEAESLDSTERGEGGFGSTGKN NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgtctggggctgctcttcttcgctttgcaaaattgagccagaatgctatttcccctact agaggttccaaacatgcagctggttatgatttgtacagtgcctatgactatgaggttcct gcaatgggaaaagttatagccaaaactgatattcaaattcagttgcctgaagggtgctat ggtcgtgtagctcctagatctggtcttgctgcaaaccaccacatcgatattggagctgga gtcattgaccgagactacagaggcaatgttggtgtcgtcatgttcaaccacagtcaaact gctttcaaggtgaacaaaggtgaccgagtggctcagctcatttgtgagttgatactctat ccagaaattgaggaagcagagtcattggattccacagaaagaggagagggaggatttgga tctactggtaagaactga

DBGET integrated database retrieval system