Desulfovibrio subterraneus: LN040_01515 Help Entry LN040_01515       CDS       T08953                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dsb  Desulfovibrio subterraneus Pathway dsb00020   Citrate cycle (TCA cycle) dsb01100   Metabolic pathways dsb01110   Biosynthesis of secondary metabolites dsb01120   Microbial metabolism in diverse environments dsb01200   Carbon metabolism dsb01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dsb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LN040_01515 Enzymes [BR:dsb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LN040_01515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_9 Fer4_21 Fer4_10 Fer4_4 Fer4_2 Fer4_16 Fer4_6 Fer4_8 Fer4_17 Fer4_13 Motif Other DBs NCBI-ProteinID:  WBF69264 LinkDB All DBs Position 343458..343727 Genome browser AA seq 89 aa AA seqDB search MPKKKKGQTLVCVYPDWCKGCGICVAFCPGKVLEMSALGKAEPVRPEDCINCGFCELHCP DFAISIRPREDGATCPSFPSGPPTNGEAC NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgccaaagaaaaagaaagggcagacactggtgtgtgtgtacccggattggtgtaaaggg tgcggtatttgtgtcgcattctgtccgggaaaggtgctggaaatgagcgcattgggcaag gcggagcccgtgcgtccggaagactgcatcaattgtggcttctgtgaactgcactgtcca gattttgcaatctccatccggccacgggaggatggagcaacctgtccgtcgttcccttcc ggccctccaaccaacggtgaggcttgctga

DBGET integrated database retrieval system