Dermacentor silvarum: 125940667 Help Entry 125940667         CDS       T07348                                  Name (RefSeq) 2-Hydroxyacid oxidase 1-like   KO K11517   (S)-2-hydroxy-acid oxidase [EC:1.1.3.15] Organism dsv  Dermacentor silvarum Pathway dsv00630   Glyoxylate and dicarboxylate metabolism dsv01100   Metabolic pathways dsv01200   Carbon metabolism dsv04146   Peroxisome Brite KEGG Orthology (KO) [BR:dsv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     125940667  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     125940667 Enzymes [BR:dsv01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.3  With oxygen as acceptor     1.1.3.15  (S)-2-hydroxy-acid oxidase      125940667 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FMN_dh IMPDH Glu_synthase Motif Other DBs NCBI-GeneID:  125940667 NCBI-ProteinID:  XP_049513052 LinkDB All DBs Position 10:complement(96407478..96419712) Genome browser AA seq 89 aa AA seqDB search MEIYLDSGVRKGADVVKALALGARAVFVGRPVLWGLACDGKQGVDRVLRILREELEHTMR LLGCSGTKDLCKEFVINKNHHSRPFRSTL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaaatatacctggatagcggagtgcgtaaaggtgccgacgtggttaaggcgctcgcg ctaggagctcgggcagtgttcgtgggacggcctgtgctctggggactcgcatgtgacggc aagcaaggtgtcgacagagtgctgcgcatattgagagaggagctcgagcacactatgcgt cttctcggttgttccggcactaaggacctgtgcaaagaatttgtcatcaacaagaatcac cattcgcgaccatttcgaagtaccttataa

DBGET integrated database retrieval system