Defluviitoga tunisiensis: DTL3_1242 Help Entry DTL3_1242         CDS       T03867                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dtn  Defluviitoga tunisiensis Pathway dtn00020   Citrate cycle (TCA cycle) dtn01100   Metabolic pathways dtn01110   Biosynthesis of secondary metabolites dtn01120   Microbial metabolism in diverse environments dtn01200   Carbon metabolism dtn01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dtn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DTL3_1242 Enzymes [BR:dtn01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DTL3_1242 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_10 Fer4_7 Fer4_9 Fer4_21 Fer4_16 Fer4_3 Fer4_17 Fer4_8 Fer4_4 Fer4_13 Fer4_5 Motif Other DBs NCBI-ProteinID:  CEP78540 UniProt:  A0A0C7P2J2 LinkDB All DBs Position I:1347192..1347401 Genome browser AA seq 69 aa AA seqDB search MQSTKKLYNVVINYNYCKRCGICSWICPVKAIVEGEFDIPQISDPLKCTGCLQCERMCPD FAIDVRLVE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgcaatccacaaagaaattgtataatgtagtaataaactataattactgcaagagatgt ggaatttgttcttggatttgtcctgttaaagctatagttgaaggagaatttgatattcct caaatttctgatcctcttaaatgtacaggatgtcttcagtgtgaaaggatgtgtccggat tttgcaattgatgttagattagtggaatag

DBGET integrated database retrieval system