Desulfobacula toluolica: TOL2_C31340 Help Entry TOL2_C31340       CDS       T02268                                  Symbol fdx9 Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dto  Desulfobacula toluolica Pathway dto00020   Citrate cycle (TCA cycle) dto01100   Metabolic pathways dto01110   Biosynthesis of secondary metabolites dto01120   Microbial metabolism in diverse environments dto01200   Carbon metabolism dto01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dto00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TOL2_C31340 (fdx9) Enzymes [BR:dto01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TOL2_C31340 (fdx9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_10 Fer4_2 Fer4_9 Fer4_4 Fer4_16 Fer4_6 Fer4_15 Fer4_8 Fer4_17 ETF_QO Fer4_3 Fer4_22 Fer4_13 Regnase_1_C Motif Other DBs NCBI-ProteinID:  CCK81292 UniProt:  K0NQT6 LinkDB All DBs Position 3668868..3669095 Genome browser AA seq 75 aa AA seqDB search MGKGKTSKHLIDKEWCKGCGICIHFCPKNVLEFDEYGKAQAIRPEDCILCKLCEIRCPDL AIQVMEKEEGEEKNE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgggaaaaggcaaaacgtctaaacatttaattgacaaggaatggtgcaaagggtgtggt atctgcattcatttttgtccaaaaaatgtacttgaatttgatgagtacggaaaggcacaa gcaataaggcctgaggattgtattttatgcaaactgtgcgaaattagatgccccgattta gcaatacaagtcatggaaaaagaggaaggggaagagaaaaatgaataa

DBGET integrated database retrieval system