Dactylosporangium vinaceum: Dvina_18615 Help Entry Dvina_18615       CDS       T07478                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism dvc  Dactylosporangium vinaceum Pathway dvc00261   Monobactam biosynthesis dvc01100   Metabolic pathways dvc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dvc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Dvina_18615  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:dvc01008]     Dvina_18615 Polyketide biosynthesis proteins [BR:dvc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Dvina_18615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF1599 Motif Other DBs NCBI-ProteinID:  UAB99889 LinkDB All DBs Position 4132221..4132454 Genome browser AA seq 77 aa AA seqDB search MVPVTNPFDDPDANYLVLVNDENQHSLWPVFLDVPEGWTTVFGEAGRQECLDYIDKSWTD MRPKSLIDAMAETSRGE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggtcccggtgacgaatccgttcgatgatcccgacgccaattacctggttctggtcaac gacgagaatcagcactcgctgtggcccgtcttcctcgacgtgccggagggatggacgacc gtcttcggcgaggccggccggcaggagtgcctcgactacatcgacaagtcgtggaccgac atgcggcccaagagcctgatcgacgccatggccgagaccagccgcggcgaatga

DBGET integrated database retrieval system