Nitratidesulfovibrio vulgaris RCH1: Deval_1367 Help Entry Deval_1367        CDS       T02064                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dvg  Nitratidesulfovibrio vulgaris RCH1 Pathway dvg00020   Citrate cycle (TCA cycle) dvg01100   Metabolic pathways dvg01110   Biosynthesis of secondary metabolites dvg01120   Microbial metabolism in diverse environments dvg01200   Carbon metabolism dvg01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dvg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Deval_1367 Enzymes [BR:dvg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Deval_1367 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_9 Fer4_10 Fer4_2 Fer4_4 Fer4_16 Fer4_6 Fer4_3 Fer4_8 Fer4_17 Fer4_15 Fer4_13 Motif Other DBs NCBI-ProteinID:  ADP86523 LinkDB All DBs Position complement(1565309..1565581) Genome browser AA seq 90 aa AA seqDB search MAKISKGQTLVCVYPDWCKGCGLCVAFCPGKVLELNPLGKAEVAHPEECINCGFCELHCP DFAIAIKPKASGQSCPSHGKAEPNPNSDEY NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggccaaaatcagcaaagggcagaccctcgtctgcgtgtacccggactggtgcaagggc tgcggtctctgcgtggccttctgcccgggcaaggttctcgaactcaacccccttggcaag gcggaggtggcgcaccccgaagaatgcatcaactgcggcttctgcgaattgcactgtccc gatttcgccatagccatcaagcccaaggccagcggacagtcctgcccttcacatggcaag gccgaacccaaccccaactccgacgagtactga

DBGET integrated database retrieval system