Desulfosarcina widdelii: DSCW_18740 Help Entry DSCW_18740        CDS       T06303                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dwd  Desulfosarcina widdelii Pathway dwd00020   Citrate cycle (TCA cycle) dwd00720   Carbon fixation pathways in prokaryotes dwd01100   Metabolic pathways dwd01110   Biosynthesis of secondary metabolites dwd01120   Microbial metabolism in diverse environments dwd01200   Carbon metabolism dwd01210   2-Oxocarboxylic acid metabolism Module dwd_M00009   Citrate cycle (TCA cycle, Krebs cycle) dwd_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dwd00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DSCW_18740   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     DSCW_18740 Enzymes [BR:dwd01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DSCW_18740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_9 Fer4_2 Fer4_6 Fer4_4 Fer4_16 Fer4_8 Fer4_15 Fer4_17 ETF_QO Fer4_13 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  BBO74457 UniProt:  A0A5K7ZDX9 LinkDB All DBs Position complement(1967495..1967704) Genome browser AA seq 69 aa AA seqDB search MAKPKLKAHRINRDWCKGCGICVEFCPKKVLELDKEDKAVAVRLEDCIACRMCELRCPDL AIEVVTEDG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaccaaagttgaaggcgcaccggatcaaccgggactggtgcaaggggtgcggc atctgtgtagaattctgccccaagaaggttctggaactggacaaggaggacaaggcggtg gcggttcgtctggaagactgcatcgcctgccggatgtgcgagctgcgctgtccggatctg gccatcgaggtggtgacggaggacggatga

DBGET integrated database retrieval system