Escherichia coli ABU 83972: ECABU_c07800 Help Entry ECABU_c07800      CDS       T01995                                  Symbol ybgT Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism eab  Escherichia coli ABU 83972 Pathway eab00190   Oxidative phosphorylation eab01100   Metabolic pathways eab02020   Two-component system Module eab_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eab00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ECABU_c07800 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ECABU_c07800 (ybgT) Enzymes [BR:eab01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ECABU_c07800 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ADN45360 LinkDB All DBs Position 805221..805334 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgagcacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system