Peptoclostridium acidaminophilum: EAL2_808p05030 Help Entry EAL2_808p05030    CDS       T03061                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism eac  Peptoclostridium acidaminophilum Pathway eac00020   Citrate cycle (TCA cycle) eac01100   Metabolic pathways eac01110   Biosynthesis of secondary metabolites eac01120   Microbial metabolism in diverse environments eac01200   Carbon metabolism eac01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:eac00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     EAL2_808p05030 Enzymes [BR:eac01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      EAL2_808p05030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_6 Fer4_10 Fer4_2 Fer4_21 Fer4_15 Fer4_9 Fer4_8 Fer4_16 Fer4_13 Fer4_4 Fer4_17 Fer4_3 Fer4_22 zf-C2H2_11 Fer4_18 Motif Other DBs NCBI-ProteinID:  AHM58006 UniProt:  W8UB43 LinkDB All DBs Position EAL2_808p:complement(508720..508917) Genome browser AA seq 65 aa AA seqDB search MKVKVDAIRCKQCELCAANCPKKAITFSEEINEFGYQTVVVDHEKCIGCGICYTMCPDGV YEILG NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgaaggtaaaggttgatgcaataagatgcaagcagtgcgagctttgcgcggcaaactgc cctaaaaaagccataacattttctgaggaaataaacgagtttggttatcaaactgtagtt gtggatcatgaaaaatgcataggctgcggcatatgctatactatgtgtcctgacggcgta tatgaaattctaggatag

DBGET integrated database retrieval system