Ensifer adhaerens OV14: OV14_2989 Help Entry OV14_2989         CDS       T03054                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ead  Ensifer adhaerens OV14 Pathway ead00790   Folate biosynthesis ead01100   Metabolic pathways ead01240   Biosynthesis of cofactors Module ead_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ead00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     OV14_2989 (folB) Enzymes [BR:ead01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      OV14_2989 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      OV14_2989 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      OV14_2989 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AHK44498 UniProt:  A0AA86E829 LinkDB All DBs Position 1:complement(2872093..2872461) Genome browser AA seq 122 aa AA seqDB search MSATYTITLKNCAFFARHGVLDEEEFLGQRFFVDAELEVEQGSALVDDSIDDTVHYGIAF TEIERIVTGRRRYLIEALALEVAKTLCVRFPQVRRAKVSVRKPNAPVPGILDYVEVTVEH VA NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgacctatacgatcaccctgaaaaactgtgccttctttgcgcgccatggcgtt ctcgacgaggaagaattcctcgggcaacggtttttcgtcgatgcggagcttgaagtggag caaggctcggcgctggtcgatgattcgatcgacgacaccgtgcattacggcatcgccttt accgaaatcgagcgcatcgtcaccggtcggcggcgctatctgatcgaggcgctggcgctc gaggtcgcaaagaccctgtgcgtgcgttttccgcaggtccggcgtgccaaggtctccgtc cgcaagccgaatgcaccggttcccggaattctcgattatgtcgaagtcacggtcgagcac gtcgcctga

DBGET integrated database retrieval system