Equus asinus (ass): 106843256 Help Entry 106843256         CDS       T04645                                  Name (RefSeq) cytochrome P450 2A6-like   KO K07411   cytochrome P450 family 2 subfamily A [EC:1.14.14.1] Organism eai  Equus asinus (ass) Pathway eai00830   Retinol metabolism eai01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:eai00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00830 Retinol metabolism     106843256  09180 Brite Hierarchies   09181 Protein families: metabolism    00199 Cytochrome P450 [BR:eai00199]     106843256 Enzymes [BR:eai01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor     1.14.14.1  unspecific monooxygenase      106843256 Cytochrome P450 [BR:eai00199]  Cytochrome P450, animal type   CYP2 family    106843256 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  p450 Motif Other DBs NCBI-GeneID:  106843256 NCBI-ProteinID:  XP_044616064 LinkDB All DBs Position 26:11514675..11515565 Genome browser AA seq 100 aa AA seqDB search MAPMLSLPSATPCPDCRPSPKTPPLDFSYDSAKVHEEIDRVIGKNRQPKFEDRAKMPYTE AVIHEIQRFGDVIPMSLARRVIKDTKFRGFLIPKVLLCPA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctcctatgctaagcctaccgagtgccactccctgccctgattgcagaccatccccg aagactcctcccttggacttttcctatgattctgccaaggttcatgaggagattgatcga gtgattggcaagaaccgtcagcccaagtttgaggaccgggccaagatgccctacacagag gcagtgatccacgaaatccaaagatttggagatgtgatccccatgagcctggcccgtaga gttatcaaggataccaagtttcggggtttcctcatccccaaggtgctgctctgccctgcc tag

DBGET integrated database retrieval system