Exiguobacterium antarcticum: Eab7_0062 Help Entry Eab7_0062         CDS       T02258                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ean  Exiguobacterium antarcticum Pathway ean00790   Folate biosynthesis ean01100   Metabolic pathways ean01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ean00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Eab7_0062 (folB) Enzymes [BR:ean01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Eab7_0062 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Eab7_0062 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Eab7_0062 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AFS69226 UniProt:  K0A913 LinkDB All DBs Position 78456..78827 Genome browser AA seq 123 aa AA seqDB search MDRIQVTGMRFYGYHGVFAEETKLGQRFNVDLSIGLDLSSAGKTDDLRESVNYAELYNVT KQVVEGAPLQLVEALAERIAAHVLLLDSRILETTIKVIKPDPPIAGHYEHVAVEIHRKRA DDQ NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggatcgaatacaagtgaccggtatgcgtttttacggctaccatggtgtgtttgcagag gaaaccaagttaggacaacgctttaacgtcgatttatcgattggtctggatttatcaagt gcgggtaagaccgatgatttacgggaaagcgtcaattacgcggaattgtacaatgttaca aaacaggtcgtcgaaggggcaccgttacagctcgtcgaagcgttggccgagcggatcgca gcgcacgtcctgttgctggattcacgaattcttgaaacgacgatcaaggtcatcaaaccc gatcctccgattgccgggcactatgaacatgtcgctgttgaaattcaccggaaacgagcg gatgatcaatga

DBGET integrated database retrieval system