Xiamenia xianingshaonis: J7S26_02955 Help Entry J7S26_02955       CDS       T08443                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ebz  Xiamenia xianingshaonis Pathway ebz00020   Citrate cycle (TCA cycle) ebz01100   Metabolic pathways ebz01110   Biosynthesis of secondary metabolites ebz01120   Microbial metabolism in diverse environments ebz01200   Carbon metabolism ebz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ebz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     J7S26_02955 Enzymes [BR:ebz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      J7S26_02955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_6 Fer4_10 Fer4_9 Fer4_16 Fer4_15 Fer4_13 Fer4_22 Fer4_3 Fer4_4 Fer4_17 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  QTU84886 UniProt:  A0A9E6MSI7 LinkDB All DBs Position 830857..831063 Genome browser AA seq 68 aa AA seqDB search MARVEVDDFFCKGCGLCVDVCPVHILELDNAVITAKGYHPAHCIDKDRCTGCASCALMCP DAAITVWR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcaagggtcgaagtagacgactttttctgcaaagggtgcggtctgtgcgtggacgtg tgccctgtgcatatcttagagctcgacaacgcggtcatcacggcgaagggctaccacccg gcacattgcatcgacaaggaccgctgcactggctgtgcgtcgtgcgcgcttatgtgccct gacgcggccattacggtatggaggtag

DBGET integrated database retrieval system