Ehrlichia canis: Ecaj_0397 Help Entry Ecaj_0397         CDS       T00270                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ecn  Ehrlichia canis Pathway ecn00790   Folate biosynthesis ecn01100   Metabolic pathways ecn01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ecn00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Ecaj_0397 Enzymes [BR:ecn01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Ecaj_0397  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Ecaj_0397  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Ecaj_0397 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AAZ68440 UniProt:  Q3YS65 LinkDB All DBs Position 596767..597123 Genome browser AA seq 118 aa AA seqDB search MKIQIHDLAVYTCIGLRRWEKVIRQKIIVDCDVTLYCYNAISDIEDTIDYSLFTDSLINF ANSNSFELLEIMASELLDYIMKDKRICHCYLKLYKPTAINIDGKVSVELESMQNDVNT NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgaagatacagattcatgatttggctgtatatacttgtattgggttacgtcgttgggaa aaagtaataagacaaaagataatagtagattgtgatgtaacactttattgttataatgct atctctgatattgaagatactattgattatagtttatttactgatagtttaattaacttt gctaattctaatagctttgaattgttagagataatggcgtcggaactattggattatatt atgaaagataagagaatttgtcattgttatttaaaattgtataaacctactgctataaat atcgatggtaaagttagtgttgaattagagtctatgcaaaatgatgtcaatacttaa

DBGET integrated database retrieval system