Candidatus Electrothrix communis: QTN59_03470 Help Entry QTN59_03470       CDS       T09821                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ecom  Candidatus Electrothrix communis Pathway ecom00020   Citrate cycle (TCA cycle) ecom01100   Metabolic pathways ecom01110   Biosynthesis of secondary metabolites ecom01120   Microbial metabolism in diverse environments ecom01200   Carbon metabolism ecom01210   2-Oxocarboxylic acid metabolism Module ecom_M00009   Citrate cycle (TCA cycle, Krebs cycle) ecom_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:ecom00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     QTN59_03470 Enzymes [BR:ecom01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      QTN59_03470 BRITE hierarchy Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_9 Fer4_16 Fer4_10 Fer4_8 Fer4_17 Fer4_4 Fer4_6 Fer4_22 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  WLE97898 LinkDB All DBs Position 824196..824450 Genome browser AA seq 84 aa AA seqDB search MKNNTKKKKQFDVSFYYDWCKSCGICMAFCPQKIIRPGKNAKPEILDKDGCVGCRFCEMH CPDFAITVSERKFYQRTLREADDD NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgaagaacaacacaaaaaaaaagaaacagtttgatgtctctttttattatgattggtgt aaaagctgtggtatctgtatggccttttgtccgcaaaaaatcatcaggcccggcaaaaac gcaaaaccggagatccttgataaagatggctgtgtaggctgtcgattctgcgagatgcat tgcccagattttgccataaccgtatctgagcgcaaattttatcagagaaccctgcgggag gcggacgatgactga

DBGET integrated database retrieval system