Edaphobacter sp. 4G125: H7846_17475 Help Entry H7846_17475       CDS       T08591                                  Symbol pheA Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism edg  Edaphobacter sp. 4G125 Pathway edg00400   Phenylalanine, tyrosine and tryptophan biosynthesis edg01100   Metabolic pathways edg01110   Biosynthesis of secondary metabolites edg01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:edg00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     H7846_17475 (pheA) Enzymes [BR:edg01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      H7846_17475 (pheA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 HTH_AsnC-type Motif Other DBs NCBI-ProteinID:  QNI36705 UniProt:  A0A7G8BVY5 LinkDB All DBs Position 4158717..4158974 Genome browser AA seq 85 aa AA seqDB search MEISDWRKKIDELDEQIVRLLNQRAEAAHAIGKLKHQSSAPVYEPNREKEVFEHVRRSNP GPLSETEVVDIYERVIDVMRALQKK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggagatctctgactggcgcaaaaagatcgatgagctcgacgagcagatcgttcgcctt ctcaaccagcgagctgaagccgcacacgccattggcaagctcaagcaccagagcagcgct ccggtttatgaaccgaatcgagagaaggaagtctttgagcatgtgcgccgttcgaaccct ggccccctctctgagactgaggtcgtcgacatctatgagcgagtcatcgacgtaatgcgc gcccttcagaagaaatga

DBGET integrated database retrieval system