Enterococcus faecalis V583: EF3269 Help Entry EF3269            CDS       T00123                                  Symbol folB Name (RefSeq) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism efa  Enterococcus faecalis V583 Pathway efa00790   Folate biosynthesis efa01100   Metabolic pathways efa01240   Biosynthesis of cofactors Module efa_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:efa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EF3269 (folB) Enzymes [BR:efa01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      EF3269 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      EF3269 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      EF3269 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB CotE Motif Other DBs NCBI-GeneID:  1202103 NCBI-ProteinID:  NP_816866 UniProt:  Q82Z10 LinkDB All DBs Position complement(3143176..3143538) Genome browser AA seq 120 aa AA seqDB search MDKIRINNLKFFTKNGVLAEEKRLGQQVEIDLEMQLSLAEAGRTDDVTQTVNYAEVNELI AQRVNNHSYDLIEGLASAILDDISADYQEQLNKIIIKIRKYSVPMPGLFDNIEIEMEREV NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggataaaattagaatcaacaacttgaaatttttcacaaaaaatggtgttttggcagaa gaaaaacgtctaggacagcaagtagaaatcgaccttgaaatgcagttgtcgttagctgag gcagggcgaacagatgatgtcactcaaactgtcaattatgccgaagtgaatgaattgatt gcccaacgagtaaacaatcactcgtacgatttaatcgaaggtttagcgagtgctatttta gatgatatttccgcagattatcaagaacaattgaacaaaattatcattaaaattagaaaa tatagtgtgccgatgcccgggctttttgacaatattgaaattgaaatggagcgagaagta tag

DBGET integrated database retrieval system