Eggerthella guodeyinii: GS424_009730 Help Entry GS424_009730      CDS       T07376                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism egd  Eggerthella guodeyinii Pathway egd00020   Citrate cycle (TCA cycle) egd01100   Metabolic pathways egd01110   Biosynthesis of secondary metabolites egd01120   Microbial metabolism in diverse environments egd01200   Carbon metabolism egd01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:egd00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     GS424_009730 Enzymes [BR:egd01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      GS424_009730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_9 Fer4_10 Fer4_15 Fer4_21 Fer4_16 Fer4_4 Fer4_3 Fer4_22 Fer4_13 Fer4_8 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  QOS66835 UniProt:  A0A6L7ITH8 LinkDB All DBs Position complement(2309476..2309682) Genome browser AA seq 68 aa AA seqDB search MARISVDDSFCKGCGLCVDACPERIMALDHDKITAKGYHPAYCTDMDACTGCMSCATMCP DVAITVER NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcgagaatcagcgtagacgactccttctgcaaggggtgcggcctgtgcgtcgacgcg tgccccgagcggatcatggcgctcgaccacgacaagatcaccgcgaagggctaccacccc gcgtactgcaccgacatggatgcgtgcacgggctgcatgtcttgcgcgacgatgtgccct gacgttgcgatcacggtagagaggtag

DBGET integrated database retrieval system