Eurypyga helias (sunbittern): 104507363 Help Entry 104507363         CDS       T08356                                  Symbol FTH1 Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ehs  Eurypyga helias (sunbittern) Pathway ehs00860   Porphyrin metabolism ehs04216   Ferroptosis ehs04217   Necroptosis Brite KEGG Orthology (KO) [BR:ehs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     104507363 (FTH1)  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     104507363 (FTH1)    04217 Necroptosis     104507363 (FTH1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ehs04147]     104507363 (FTH1) Enzymes [BR:ehs01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      104507363 (FTH1) Exosome [BR:ehs04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104507363 (FTH1)   Exosomal proteins of bladder cancer cells    104507363 (FTH1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  104507363 NCBI-ProteinID:  XP_010146914 UniProt:  A0A093KYQ4 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search KPDRDDWENGLTAMECALHLEKNVNQSLLELHKLATEKNDPHLCDFIETHYLDEQVKAIK ELGDHVTNLRKMGAPKYGMAEYLFDKHTLGDSDNES NT seq 291 nt NT seq  +upstreamnt  +downstreamnt aagccagatcgtgatgactgggagaatgggctgactgcaatggagtgtgccctgcacctg gagaagaatgtgaaccagtcactgttagaactgcacaaactggcaactgaaaagaatgac ccacatttgtgtgacttcattgagactcactacctggatgaacaggtgaaagccatcaaa gagctgggtgaccatgtgaccaacctgcggaagatgggggcaccaaaatatggcatggca gagtacctctttgacaagcatactcttggggacagtgacaatgagagctga

DBGET integrated database retrieval system