Eumetopias jubatus (Steller sea lion): 114202996 Help Entry 114202996         CDS       T07240                                  Name (RefSeq) protein kinase C alpha type-like   KO K19662   classical protein kinase C beta type [EC:2.7.11.13] Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju01521   EGFR tyrosine kinase inhibitor resistance eju04010   MAPK signaling pathway eju04012   ErbB signaling pathway eju04014   Ras signaling pathway eju04015   Rap1 signaling pathway eju04020   Calcium signaling pathway eju04062   Chemokine signaling pathway eju04064   NF-kappa B signaling pathway eju04066   HIF-1 signaling pathway eju04070   Phosphatidylinositol signaling system eju04071   Sphingolipid signaling pathway eju04150   mTOR signaling pathway eju04270   Vascular smooth muscle contraction eju04310   Wnt signaling pathway eju04370   VEGF signaling pathway eju04510   Focal adhesion eju04540   Gap junction eju04613   Neutrophil extracellular trap formation eju04650   Natural killer cell mediated cytotoxicity eju04662   B cell receptor signaling pathway eju04666   Fc gamma R-mediated phagocytosis eju04670   Leukocyte transendothelial migration eju04713   Circadian entrainment eju04720   Long-term potentiation eju04723   Retrograde endocannabinoid signaling eju04724   Glutamatergic synapse eju04725   Cholinergic synapse eju04726   Serotonergic synapse eju04727   GABAergic synapse eju04728   Dopaminergic synapse eju04730   Long-term depression eju04750   Inflammatory mediator regulation of TRP channels eju04911   Insulin secretion eju04912   GnRH signaling pathway eju04916   Melanogenesis eju04918   Thyroid hormone synthesis eju04919   Thyroid hormone signaling pathway eju04921   Oxytocin signaling pathway eju04925   Aldosterone synthesis and secretion eju04928   Parathyroid hormone synthesis, secretion and action eju04929   GnRH secretion eju04931   Insulin resistance eju04933   AGE-RAGE signaling pathway in diabetic complications eju04935   Growth hormone synthesis, secretion and action eju04960   Aldosterone-regulated sodium reabsorption eju04961   Endocrine and other factor-regulated calcium reabsorption eju04970   Salivary secretion eju04971   Gastric acid secretion eju04972   Pancreatic secretion eju04973   Carbohydrate digestion and absorption eju05017   Spinocerebellar ataxia eju05022   Pathways of neurodegeneration - multiple diseases eju05031   Amphetamine addiction eju05032   Morphine addiction eju05140   Leishmaniasis eju05143   African trypanosomiasis eju05146   Amoebiasis eju05161   Hepatitis B eju05163   Human cytomegalovirus infection eju05164   Influenza A eju05170   Human immunodeficiency virus 1 infection eju05171   Coronavirus disease - COVID-19 eju05200   Pathways in cancer eju05205   Proteoglycans in cancer eju05206   MicroRNAs in cancer eju05207   Chemical carcinogenesis - receptor activation eju05214   Glioma eju05223   Non-small cell lung cancer eju05225   Hepatocellular carcinoma eju05231   Choline metabolism in cancer eju05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114202996    04012 ErbB signaling pathway     114202996    04014 Ras signaling pathway     114202996    04015 Rap1 signaling pathway     114202996    04310 Wnt signaling pathway     114202996    04370 VEGF signaling pathway     114202996    04064 NF-kappa B signaling pathway     114202996    04066 HIF-1 signaling pathway     114202996    04020 Calcium signaling pathway     114202996    04070 Phosphatidylinositol signaling system     114202996    04071 Sphingolipid signaling pathway     114202996    04150 mTOR signaling pathway     114202996  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     114202996    04540 Gap junction     114202996  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114202996    04650 Natural killer cell mediated cytotoxicity     114202996    04662 B cell receptor signaling pathway     114202996    04666 Fc gamma R-mediated phagocytosis     114202996    04670 Leukocyte transendothelial migration     114202996    04062 Chemokine signaling pathway     114202996   09152 Endocrine system    04911 Insulin secretion     114202996    04929 GnRH secretion     114202996    04912 GnRH signaling pathway     114202996    04921 Oxytocin signaling pathway     114202996    04935 Growth hormone synthesis, secretion and action     114202996    04918 Thyroid hormone synthesis     114202996    04919 Thyroid hormone signaling pathway     114202996    04928 Parathyroid hormone synthesis, secretion and action     114202996    04916 Melanogenesis     114202996    04925 Aldosterone synthesis and secretion     114202996   09153 Circulatory system    04270 Vascular smooth muscle contraction     114202996   09154 Digestive system    04970 Salivary secretion     114202996    04971 Gastric acid secretion     114202996    04972 Pancreatic secretion     114202996    04973 Carbohydrate digestion and absorption     114202996   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     114202996    04961 Endocrine and other factor-regulated calcium reabsorption     114202996   09156 Nervous system    04724 Glutamatergic synapse     114202996    04727 GABAergic synapse     114202996    04725 Cholinergic synapse     114202996    04728 Dopaminergic synapse     114202996    04726 Serotonergic synapse     114202996    04720 Long-term potentiation     114202996    04730 Long-term depression     114202996    04723 Retrograde endocannabinoid signaling     114202996   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     114202996   09159 Environmental adaptation    04713 Circadian entrainment     114202996  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114202996    05206 MicroRNAs in cancer     114202996    05205 Proteoglycans in cancer     114202996    05207 Chemical carcinogenesis - receptor activation     114202996    05231 Choline metabolism in cancer     114202996   09162 Cancer: specific types    05225 Hepatocellular carcinoma     114202996    05214 Glioma     114202996    05223 Non-small cell lung cancer     114202996   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     114202996    05161 Hepatitis B     114202996    05171 Coronavirus disease - COVID-19     114202996    05164 Influenza A     114202996    05163 Human cytomegalovirus infection     114202996   09174 Infectious disease: parasitic    05146 Amoebiasis     114202996    05140 Leishmaniasis     114202996    05143 African trypanosomiasis     114202996   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     114202996    05022 Pathways of neurodegeneration - multiple diseases     114202996   09165 Substance dependence    05031 Amphetamine addiction     114202996    05032 Morphine addiction     114202996   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     114202996   09167 Endocrine and metabolic disease    04931 Insulin resistance     114202996    04933 AGE-RAGE signaling pathway in diabetic complications     114202996   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     114202996  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:eju01001]     114202996 Enzymes [BR:eju01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      114202996 Protein kinases [BR:eju01001]  Serine/threonine kinases: AGC group   PKC family [OT]    114202996 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  C2 C1_1 C1_2 FtrD-like zf-RING-like PHD RNA_POL_M_15KD Motif Other DBs NCBI-GeneID:  114202996 NCBI-ProteinID:  XP_027952191 LinkDB All DBs Position Unknown AA seq 241 aa AA seqDB search MCFFFLQDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPS LCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESK QKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKM PASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEVRISTKLVEPSFLWEVWPQEGPE S NT seq 724 nt NT seq  +upstreamnt  +downstreamnt atgtgcttcttcttcctgcaggaccccagaagcaagcacaagtttaaaatccacacctat ggaagccccaccttttgtgatcactgtgggtccttgctgtatggacttatccatcaaggg atgaaatgtgacacctgtgacatgaatgtgcacaagcagtgtgtgataaacgtgcccagc ctctgcgggatggaccacacggagaagcggggccggatctacctgaaggcggaggtcacc gatgagaagctccatgtcaccgtacgagatgcaaaaaatctaattcctatggatccaaat gggctttcagatccgtatgtgaagctgaaacttattcctgatccgaagaatgaaagcaaa cagaaaaccaaaaccatccgctccacactaaacccccaatggaatgagtcctttacgttc aaattaaaaccttcggataaagaccgacggctgtccgtagaaatctgggactgggatcga acaacaaggaatgatttcatgggatccctttcctttggagtctcggagctgatgaagatg ccggccagtggatggtacaagctgcttaaccaagaggaaggtgagtactacaacgtaccc attccagaaggggatgaagaaggcaacgtggagctcaggcagaaattcgaggtgagaata tcaacgaaattagtggaaccgtcttttctttgggaagtttggcctcaggaagggccagag tctt

DBGET integrated database retrieval system