Escherichia coli clone D i2: i02_3503 Help Entry i02_3503          CDS       T02004                                  Symbol folB Name (GenBank) bifunctional dihydroneopterin   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism eld  Escherichia coli clone D i2 Pathway eld00790   Folate biosynthesis eld01100   Metabolic pathways eld01240   Biosynthesis of cofactors Module eld_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:eld00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     i02_3503 (folB) Enzymes [BR:eld01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      i02_3503 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      i02_3503 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      i02_3503 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF2866 Motif Other DBs NCBI-ProteinID:  AER86039 LinkDB All DBs Position complement(3515634..3516005) Genome browser AA seq 123 aa AA seqDB search MMDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAET VVSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERGNNLK ENN NT seq 372 nt NT seq  +upstreamnt  +downstreamnt gtgatggatattgtatttatagagcaactttcggtaatcaccactattggtgtttacgac tgggaacagaccatcgaacagaagttagtgttcgatatcgaaatggcgtgggataaccgt aaagcggcgaaaagtgatgatgtggcggattgcctcagttacgctgacattgcagaaacg gtggtcagccacgtcgagggggcgcgttttgcgctggtggaacgcgtggctgaagaggtg gcggagctgctgttagcacgcttcaactcgccgtgggtgcgtatcaaactcagcaagcca ggcgcagtggcgcgggcggcgaatgttggcgtaatcattgagcgtggcaataatctgaaa gaaaataattaa

DBGET integrated database retrieval system