Escherichia coli P12b: P12B_c3154 Help Entry P12B_c3154        CDS       T02030                                  Symbol folB Name (GenBank) Putative kinase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism elp  Escherichia coli P12b Pathway elp00790   Folate biosynthesis elp01100   Metabolic pathways elp01240   Biosynthesis of cofactors Module elp_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:elp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     P12B_c3154 (folB) Enzymes [BR:elp01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      P12B_c3154 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      P12B_c3154 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      P12B_c3154 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF2866 Motif Other DBs NCBI-ProteinID:  AFG41985 LinkDB All DBs Position complement(3450920..3451288) Genome browser AA seq 122 aa AA seqDB search MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAETV VSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERGNNLKE NN NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggatattgtatttatagagcaactttcggtaatcaccactattggtgtttacgactgg gaacagaccatcgaacagaagttagtgttcgatatcgaaatggcgtgggataaccgtaaa gcggcgaaaagtgatgatgtggcggattgcctcagttacgctgacattgcagaaacggtg gtcagccacgtcgagggggcgcgttttgcgctggtggaacgcgtggctgaagaggtggcg gagctgctgttagcacgcttcaactcgccgtgggtgcgtatcaaactcagcaagccaggc gcagtggcgcgggcggcgaatgttggcgtaatcattgagcgtggcaataatctgaaagaa aataattaa

DBGET integrated database retrieval system