Escherichia coli P12b: P12B_c3972 Help Entry P12B_c3972        CDS       T02030                                  Symbol hemG Name (GenBank) Protoporphyrinogen oxidase   KO K00230   menaquinone-dependent protoporphyrinogen oxidase [EC:1.3.5.3] Organism elp  Escherichia coli P12b Pathway elp00860   Porphyrin metabolism elp01100   Metabolic pathways elp01110   Biosynthesis of secondary metabolites elp01240   Biosynthesis of cofactors Module elp_M00121   Heme biosynthesis, plants and bacteria, glutamate => heme Brite KEGG Orthology (KO) [BR:elp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     P12B_c3972 (hemG) Enzymes [BR:elp01000]  1. Oxidoreductases   1.3  Acting on the CH-CH group of donors    1.3.5  With a quinone or related compound as acceptor     1.3.5.3  protoporphyrinogen IX dehydrogenase (quinone)      P12B_c3972 (hemG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Flavodoxin_5 Motif Other DBs NCBI-ProteinID:  AFG42788 LinkDB All DBs Position 4342427..4342735 Genome browser AA seq 102 aa AA seqDB search MPSAFYSVNLVARKPEKRTPQTNSYARKFLMNSQWRPDRCAVIAGALRYPRYRWYDRFMI KLIMKMSGGETDTRKEVVYTDWEQVANFAREIAHLTDKPTLK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgccgagcgccttttactccgtgaatctggtggcgcgcaaaccggagaagcgtactcca cagaccaacagctacgcgcgcaagtttctgatgaactcgcaatggcgtcccgatcgctgc gcggtcattgccggggcgctgcgttacccacgttatcgctggtacgaccgttttatgatc aagctgattatgaagatgtcaggcggtgaaacggatacgcgcaaagaagttgtctatacc gattgggagcaggtggcgaatttcgcccgagaaatcgcccatttaaccgacaaaccgacg ctgaaataa

DBGET integrated database retrieval system