Esox lucius (northern pike): 105022136 Help Entry 105022136         CDS       T04894                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism els  Esox lucius (northern pike) Pathway els04010   MAPK signaling pathway els04012   ErbB signaling pathway els04068   FoxO signaling pathway els04137   Mitophagy - animal els04140   Autophagy - animal els04150   mTOR signaling pathway els04210   Apoptosis els04218   Cellular senescence els04370   VEGF signaling pathway els04371   Apelin signaling pathway els04540   Gap junction els04625   C-type lectin receptor signaling pathway els04810   Regulation of actin cytoskeleton els04910   Insulin signaling pathway els04912   GnRH signaling pathway els04914   Progesterone-mediated oocyte maturation els04916   Melanogenesis Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105022136 (kras)    04012 ErbB signaling pathway     105022136 (kras)    04370 VEGF signaling pathway     105022136 (kras)    04371 Apelin signaling pathway     105022136 (kras)    04068 FoxO signaling pathway     105022136 (kras)    04150 mTOR signaling pathway     105022136 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105022136 (kras)    04137 Mitophagy - animal     105022136 (kras)   09143 Cell growth and death    04210 Apoptosis     105022136 (kras)    04218 Cellular senescence     105022136 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     105022136 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105022136 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105022136 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     105022136 (kras)    04912 GnRH signaling pathway     105022136 (kras)    04914 Progesterone-mediated oocyte maturation     105022136 (kras)    04916 Melanogenesis     105022136 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:els04131]     105022136 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:els04031]     105022136 (kras) Membrane trafficking [BR:els04131]  Endocytosis   Macropinocytosis    Ras GTPases     105022136 (kras) GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105022136 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  105022136 NCBI-ProteinID:  XP_010888600 UniProt:  A0A3P8ZDZ6 LinkDB All DBs Position LG19:complement(18631729..18649408) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRLYRLKKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctggtggtggtgggagcaggaggcgtgggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccattgaggactcgtac aggaagcaggtggtgattgacggggagacgtgtcttctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtctttgccatcaacaacaccaaatcctttgaggacatccaccactatagagagcagatt aagcgtgtgaaagactctgaggatgtacccatggtgctggtggggaacaagtgtgacctg ccgtcccggacagtggacaccaagcaggctcaggacttagcacgcagctatggtatccca ttcatcgagacctcagccaaaaccagacagagagtggaggatgccttttacactctggta cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccacgctgt gtcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system