Epinephelus lanceolatus (giant grouper): 117262618 Help Entry 117262618         CDS       T07331                                  Symbol fth1b Name (RefSeq) ferritin, heavy polypeptide 1b   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely00860   Porphyrin metabolism ely04216   Ferroptosis ely04217   Necroptosis Brite KEGG Orthology (KO) [BR:ely00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     117262618 (fth1b)  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     117262618 (fth1b)    04217 Necroptosis     117262618 (fth1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ely04147]     117262618 (fth1b) Enzymes [BR:ely01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      117262618 (fth1b) Exosome [BR:ely04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117262618 (fth1b)   Exosomal proteins of bladder cancer cells    117262618 (fth1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin FCH Rubrerythrin Motif Other DBs NCBI-GeneID:  117262618 NCBI-ProteinID:  XP_033491544 LinkDB All DBs Position 11:26420274..26422927 Genome browser AA seq 119 aa AA seqDB search MTSQIRQNFHQDCEAAINRQINLELYASYVYLSMAYYFDRDDKFLPNFVKFFHAQSKEER EHAEKLMSLQNKSGGKIFLQDIRKPDRDEWGSGLEALECSLQLEKSVNQSLLDLQKMAT NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgacttcgcaaatccgacagaacttccaccaggactgtgaggctgccattaacagacag ataaacctggagctctatgcctcttatgtttatctctccatggcatactactttgatagg gacgataaattcctgccaaactttgtgaagttctttcacgcacagtccaaagaggagcgc gagcacgcagagaagctgatgagtctgcagaacaaaagtggaggcaaaatttttctgcag gacatcaggaaacctgatagagatgagtggggaagcggcctggaggctttggagtgctcc ttgcagctggagaaaagtgtaaaccaatccctgctggacctgcagaaaatggcgacctaa

DBGET integrated database retrieval system